- Recombinant Zea mays Cytochrome b-c1 complex subunit Rieske, mitochondrial
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1031825
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 29,835 Da
- E Coli or Yeast
- 62-273
- Cytochrome b-c1 complex subunit Rieske, mitochondrial
Sequence
STETVVPRNQDAGLADLPATVAAVKNPNPKVVYDEYNHERYPPGDPSKRAFAYFVLSGGRFIYASLLRLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEDDIKLANSVDVASLRHPEQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPFNLEVPTYSFLEENKLLVG